accessibility menu, dialog, popup

UserName
Viewing profile as user:

Primary Antibodies

Primary antibodies are immunoglobulins that recognize and bind to a specific antigen of interest with high affinity and specificity to purify, detect, and measure that antigen. Includes antibody pairs for specific biochemical applications.
All Primary Antibodies (1,885,942)
Primary Antibody Matched Pairs (7,088)
Protein Interaction Antibody Pairs (1,403)
Protein Phosphorylation Antibody Pairs (73)

Filtered Search Results

Products from some of our suppliers do not display in filtered search results. Please clear all filters to see these products.

Narrow Results

Narrow Results

category

special offers

  • (1)
  • (4)
  • (1)

brands

  • (2)
  • (1)
  • (1)
  • (28)
  • (2)
  • (2)
  • (969)
  • (76,148)
  • (14,166)
  • (41)
  • (6)
  • (59,912)
  • (1)
  • (110)
  • (259)
  • (2)
  • (1,310)
  • (575)
  • (2)
  • (1)
  • (11)
  • (1)
  • (1)
  • (24)
  • (1)
  • (4)
  • (4)
  • (1)
  • (13)
  • (1)
  • (1)
  • (2)
  • (24)
  • (3)
  • (4)
  • (2)
  • (1)
  • (10,631)
  • (397)
  • (1)
  • (12)
  • (1)
  • (8)
  • (3)
  • (2)
  • (1)
  • (1)
  • (190)
  • (55)
  • (1)
  • (6)
  • (1)
  • (63)
  • (3)
  • (15)
  • (1)
  • (12)
  • (2)
  • (1)
  • (76)
  • (5)
  • (17)
  • (19)
  • (1)
  • (14,087)
  • (2)
  • (1)
  • (1)
  • (32,198)
  • (83)
  • (468)
  • (2)
  • (1)
  • (11,565)
  • (1)
  • (1)
  • (51)
  • (3,050)
  • (6)
  • (470)
  • (104)
  • (22,741)
  • (1)
  • (4,434)
  • (1)
  • (1)
  • (1)
  • (1)
  • (16,227)
  • (1)
  • (76)
  • (18,947)
  • (139)
  • (203)
  • (3)
  • (62)
  • (1)
  • (1)
  • (2)
  • (28)
  • (5)
  • (1)
  • (3)
  • (10)
  • (415)
  • (2)
  • (13,812)
  • (29)
  • (1)
  • (2)
  • (45)
  • (42)
  • (11,458)
  • (1)
  • (2)
  • (8)
  • (6)
  • (2)
  • (20)
  • (2)
  • (2)
  • (54)
  • (1)
  • (2)
  • (12)
  • (20)
  • (1)
  • (34)
  • (2)
  • (1)
  • (40)
  • (2)
  • (1)
  • (62)
  • (53)
  • (453)
  • (55)
  • (10)
  • (3)
  • (78)
  • (12)
  • (11)
  • (1,196)
  • (8)
  • (9)
  • (1)
  • (20)
  • (11)
  • (1)
  • (23)
  • (3)
  • (1)
  • (3)
  • (5)
  • (2)
  • (59)
  • (95)
  • (1)
  • (1)
  • (171)
  • (211)
  • (4)
  • (127)
  • (2)
  • (1)
  • (692)
  • (13)
  • (912)
  • (1)
  • (106)
  • (2,102)
  • (114)
  • (2,514)
  • (1)
  • (12)
  • (1)
  • (1)
  • (972)
  • (1)
  • (1)
  • (1)
  • (2)
  • (6)
  • (122)
  • (1)
  • (63)
  • (3)
  • (2)
  • (3)
  • (1)
  • (1)
  • (8)
  • (1)
  • (298)
  • (1)
  • (1,814)
  • (2)
  • (1)
  • (1,785)
  • (3)
  • (1)
  • (1)
  • (1)
  • (1)
  • (14)
  • (6)
  • (16)
  • (1)
  • (23)
  • (11)
  • (12)
  • (2)
  • (1)
  • (2)
  • (2)
  • (143)
  • (33)
  • (1)
  • (41)
  • (1)
  • (19)
  • (3)
  • (4)
  • (1)
  • (1)
  • (5)
  • (1)
  • (2)
  • (153,579)
  • (54)
  • (2)
  • (3)
  • (3)
  • (133)
  • (1)
  • (1)
  • (9)
  • (1)
  • (118)
  • (1)
  • (2)
  • (4)
  • (191)
  • (1,157)
  • (10)
  • (2)
  • (10)
  • (8)
  • (2)
  • (36)
  • (1)
  • (1)
  • (1)
  • (112)
  • (12,115)
  • (680)
  • (165)
  • (1)
  • (6)
  • (1)
  • (8,396)
  • (1)
  • (16,429)
  • (3)
  • (16)
  • (4)
  • (137)
  • (31)
  • (111)
  • (1)
  • (3)
  • (8)
  • (6)
  • (9)
  • (3)
  • (2)
  • (1)
  • (1)
  • (1)
  • (2)
  • (2)
  • (1)
  • (12)
  • (1)
  • (1)
  • (30,468)
  • (13)
  • (1)
  • (32)
  • (1)
  • (1)
  • (6)
  • (79)
  • (1)
  • (1)
  • (11)
  • (7)
  • (1)
  • (2)
  • (1)
  • (1)
  • (1)
  • (2)
  • (24)
  • (40,281)
  • (1)
  • (11,815)
  • (1)
  • (1)
  • (1)
  • (1)
  • (1)
  • (1)
  • (1)
  • (40)
  • (7)
  • (57)
  • (15)
  • (1,246,451)
  • (3)
  • (1)
  • (5)
  • (16)
  • (4)
  • (1)
  • (28)
  • (548)
  • (1)
  • (11)
  • (2,474)
  • (2)
  • (1)
  • (4)
  • (2)
  • (2)
  • (421)
  • (1)
  • (8)
  • (4)
  • (1)
  • (1)
  • (4)
  • (1)
  • (1,426)
  • (136)
  • (1)
  • (1)
  • (1)
  • (554)
  • (19,393)
  • (1)
  • (8)
  • (1)
  • (1)
  • (1,796)
  • (2)
  • (3)
  • (6)
  • (3)
  • (703)
  • (2)
  • (1)
  • (3)
  • (1)
  • (8)
  • (1)
  • (1)
  • (5)
  • (39)
  • (1)
  • (4)
  • (1)
  • (1)
  • (6)
  • (1)
  • (2)
  • (2,873)
  • (8)
  • (1)
  • (55)
  • (2)
  • (9)
  • (1)
  • (1)
  • (1)
  • (2)
  • (2)
  • (8)
  • (5)
  • (1)
  • (14)
  • (1)
  • (1)
  • (28)
  • (241)
  • (1)
  • (3)
  • (2)
  • (17)
  • (1)
  • (1)
  • (10)
  • (10)
  • (2)
  • (1)
  • (2)
  • (40)
  • (7)

special interests

  • (154)
  • (767)
  • (165,506)
  • (71)
  • (70,529)

Quantity

  • (1)
  • (7)
  • (2)
  • (3,051)
  • (925)
  • (1,940)
  • (4,436)
Show all

Conjugate

  • (3)
  • (3)
  • (31,219)
  • (9)
  • (1)
  • (29)
  • (2,894)
Show all

Host Species

  • (564)
  • (2,888)
  • (51)
  • (1)
  • (15)
  • (1,779)
  • (726)
Show all

Applications

  • (983)
  • (2)
  • (36)
  • (23)
  • (192)
  • (1,232)
  • (3)
Show all

Target Species

  • (79)
  • (3)
  • (2)
  • (90)
  • (40)
  • (106)
  • (492)
Show all

Classification

  • (81)
  • (105)
  • (890,832)
  • (3,641)
  • (5)
  • (758,951)
  • (30,295)
Show all

Regulatory Status

  • (335)
  • (964)
  • (1,652,486)

Isotype

  • (2)
  • (1)
  • (2)
  • (1)
  • (1)
  • (1)
  • (6)
Show all

Form

  • (2,701)
  • (2,161)
  • (1,630)
  • (14)
  • (9)
  • (19)
  • (424,123)
Show all

Research Discipline

  • (1)
  • (2)
  • (1)
  • (2)
  • (1)
  • (1)
  • (1)
Show all

Search Within Results
Keyword Search:
2,146 – 2,160 of 1,816,363 results
2,146

Multicilin Antibody, R&D Systems™

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate Unconjugated
Target Species Human
Host Species Rabbit
Applications Immunocytochemistry,Immunofluorescence
Isotype IgG
Antigen Multicilin
Regulatory Status RUO
Purification Method Affinity Purified
Gene Alias IDAS, MCI, MCIN multiciliate cell differentiation 1
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez) 345643
Classification Polyclonal
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ANTDTRPGNLHGAFRGLRTDCSRSALNLSHSELEEGGSFSTRIRSHSTIRTLAFPQGNAFTIRTANGGYKFRWV
Primary or Secondary Primary
2,150

RY775 Mouse Anti-Human CD20, BD Horizon™

Mouse Monoclonal Antibody

Content And Storage The monoclonal antibody was purified from tissue culture supernatant or ascites by affinity chromatography. The antibody was conjugated to the dye under optimum conditions and unconjugated antibody and free dye were removed. Store undiluted at 4°C and protected from prolonged exposure to light. Do not freeze.
Target Species Human,Rhesus Macaque,Cynomolgus,Baboon
Host Species Mouse
Conjugate RY775
Applications Flow Cytometry
Form Liquid
Isotype IgG2b κ
Antigen CD20
Regulatory Status RUO
Gene Alias MS4A1; B1; Bp35; LEU-16; S7
Product Type Antibody
Gene ID (Entrez) 931
Formulation Aqueous buffered solution containing ≤0.09% sodium azide.
Classification Monoclonal
Immunogen Human 6.16c1.3 B cell line
Primary or Secondary Primary
Clone 2H7
2,151

Invitrogen™ Vaccinia Virus Polyclonal Antibody, HRP
GREENER_CHOICE

Rabbit Polyclonal Antibody

Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species Virus
Host Species Rabbit
Conjugate HRP
Applications ELISA,Immunohistochemistry
Form Liquid
Isotype IgG
Concentration 1.0 mg/mL
Antigen Vaccinia Virus
Regulatory Status RUO
Purification Method Protein A
Product Type Antibody
Formulation PBS with 10mg/mL BSA and 0.002% thimerosal; pH 7.2
Immunogen New York City Board of Health (NYCBOH) strain.
Classification Polyclonal
Primary or Secondary Primary
2,153

Invitrogen™ EGFR Polyclonal Antibody
GREENER_CHOICE

Rabbit Polyclonal Antibody

Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species Human,Mouse,Rat
Host Species Rabbit
Conjugate Unconjugated
Applications Flow Cytometry,Immunohistochemistry (Paraffin),Immunoprecipitation,Western Blot,Proximity Ligation Assay,Immunocytochemistry
Form Liquid
Gene Accession No. P00533, Q01279
Isotype IgG
Concentration 1.04 mg/mL
Antigen EGFR
Gene Symbols EGFR
Regulatory Status RUO
Purification Method Antigen affinity chromatography
Gene Alias 2.7.10.1; 9030024J15Rik; AI552599; avian erythroblastic leukemia viral (v-erbB) oncogene homolog; avian erythroblastic leukemia viral (v-erb-b) oncogene homolog; cell growth inhibiting protein 40; cell proliferation-inducing protein 61; EC 2.7.10.1; egf receptor; Egfr; EGFR-related peptide; epidermal growth factor receptor; epidermal growth factor receptor (erythroblastic leukemia viral (v-erb-b) oncogene homolog, avian); Epidermal growth factor receptor formerly avian erythroblastic leukemia viral (v-erbB) oncogene homolog (Erbb1); epidermal growth factor receptor, formerly avian erythroblastic leukemia viral (v-erbB) oncogene homolog (Erbb1); ERBB; ERBB1; ErbB-1; erb-b2 receptor tyrosine kinase 1; Errb1; Errp; HER1; kinase EGFR; mENA; NISBD2; Oncogene ERBB; PIG61; Proto-oncogene c-ErbB-1; receptor tyrosine-protein kinase erbB-1; Urogastrone; wa2; wa-2; Wa5; waved 2
Gene EGFR
Product Type Antibody
Gene ID (Entrez) 13649, 1956, 24329
Formulation PBS with 20% glycerol and 0.025% ProClin 300; pH 7
Immunogen Recombinant protein encompassing a sequence within the Extracellular domain of human EGFR. The exact sequence is proprietary.
Classification Polyclonal
Primary or Secondary Primary
2,154

c-Met Mouse anti-Human, Brilliant Violet 605, Clone: 3D6, BD Optibuild™

Mouse Monoclonal Antibody

Antigen c-Met
Regulatory Status RUO
Content And Storage Store undiluted at 4°C and protected from prolonged exposure to light. Do not freeze.
Gene Alias MET, cMet, HGFR, HGF receptor, AUTS9, RCCP2, SF receptor
Conjugate Brilliant Violet 605
Target Species Human
Host Species Mouse
Formulation Aqueous buffered solution containing ≤0.09% sodium azide.
Classification Monoclonal
Immunogen Human c-Met Recombinant Protein
Isotype IgG1 κ
Primary or Secondary Primary
Clone 3D6
2,155

Invitrogen™ CD3e Monoclonal Antibody (CA17.2A12)
GREENER_CHOICE

Mouse Monoclonal Antibody

Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species Canine
Host Species Mouse
Conjugate Unconjugated
Applications Flow Cytometry,Immunohistochemistry (Frozen),Immunoprecipitation,Immunocytochemistry
Form Liquid
Gene Accession No. P27597
Isotype IgG1
Concentration 1 mg/mL
Antigen CD3e
Gene Symbols Cd247, Cd3d, CD3E, CD3g
Regulatory Status RUO
Purification Method Protein A
Gene Alias 4930549J05Rik; A430104F18Rik; AI504783; antigen CD3D, delta polypeptide (TiT3 complex); antigen CD3E, epsilon polypeptide (TiT3 complex); antigen CD3G, gamma polypeptide; antigen CD3Z, zeta polypeptide; AW552088; Cd247; CD247 antigen; CD247 antigen, zeta subunit; Cd247 molecule; CD3; CD3 antigen delta chain; CD3 antigen delta polypeptide; CD3 antigen gamma chain; CD3 antigen, delta polypeptide; CD3 antigen, delta subunit; CD3 antigen, epsilon polypeptide; CD3 antigen, gamma polypeptide; CD3 antigen, zeta polypeptide; CD3 delta; CD3 epsilon; CD3 epsilon chain; CD3 epsilon subunit; CD3 epsilon subunit precursor; CD3 gamma-chain; CD3 glycoprotein; CD3 glycoprotein precursor; CD3 molecule delta polypeptide; CD3 molecule, delta; CD3 molecule, epsilon; CD3 molecule, epsilon polypeptide; CD3 molecule, gamma; CD3 molecule, gamma polypeptide; CD3 protein; CD3 TCR complex; CD3 type I transmembrane glycoprotein; CD3 type I transmembrane glycoprotein precursor; CD3 zeta chain; Cd3d; CD3D antigen delta; CD3D antigen, delta polypeptide (TiT3 complex); CD3d molecule; CD3d molecule, delta (CD3-TCR complex); CD3-DELTA; Cd3e; CD3E antigen, epsilon polypeptide; CD3E antigen, epsilon polypeptide (TiT3 complex); CD3e molecule; CD3e molecule, epsilon (CD3-TCR complex); CD3epsilon; CD3-epsilon; Cd3-eta; Cd3g; CD3G antigen, gamma polypeptide; CD3g antigen, gamma polypeptide (TiT3 complex); CD3g molecule; CD3g molecule, epsilon (CD3-TCR complex); CD3g molecule, gamma (CD3-TCR complex); CD3-GAMMA; Cd3h; CD3Q; Cd3z; CD3Z antigen, zeta polypeptide (TiT3 complex); Cd3zeta; Cd3-zeta; CD3zeta chain; CD3-zeta/eta; Ctg3; Ctg-3; FLJ18683; IMD17; IMD18; IMD19; IMD25; Leu-4; OKT3, delta chain; T cell antigen receptor complex epsilon subunit of T3; T3/TCR complex; T3d; T3e; T3g; T3Z; T-cell antigen receptor complex, epsilon subunit of T3; T-cell antigen receptor complex, gamma subunit of T3; T-cell antigen receptor complex, zeta subunit of CD3; T-cell receptor CD3 epsilon chain; T-cell receptor CD3 epsilon subunit; T-cell receptor CD3 subunit zeta; T-cell receptor CD3, subunit zeta; T-cell receptor T3 delta chain; T-cell receptor T3 eta chain; T-cell receptor T3 gamma chain; T-cell receptor T3 zeta chain; T-cell receptor zeta chain; T-cell surface antigen T3/Leu-4 epsilon chain; T-cell surface glycoprotein CD3 delta chain; T-cell surface glycoprotein CD3 epsilon chain; T-cell surface glycoprotein CD3 gamma chain; T-cell surface glycoprotein CD3 zeta chain; T-cell surface protein; TcR CD3 delta-chain; TcR CD3 gamma-chain; TCR zeta chain; TCR zeta chain subunit; TCRE; Tcrk; TCRZ; TCRzeta; TiT3 complex; type I transmembrane protein; T-cell surface molecule CD3
Gene CD3E
Product Type Antibody
Gene ID (Entrez) 442981, 479419, 489383, 611571
Formulation PBS with 0.09% sodium azide; pH 7.4
Immunogen Affinity enriched TCR/CD3 membrane proteins isolated from thymocytes and the T cell line CLGL-90.
Classification Monoclonal
Primary or Secondary Primary
Clone CA17.2A12
2,156

Invitrogen™ Norovirus VP1 Polyclonal Antibody
GREENER_CHOICE

Rabbit Polyclonal Antibody

Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species Virus
Host Species Rabbit
Conjugate Unconjugated
Applications Immunohistochemistry (Paraffin),Western Blot
Form Liquid
Isotype IgG
Concentration 1.37 mg/mL
Antigen Norovirus VP1
Regulatory Status RUO
Purification Method Antigen affinity chromatography
Gene Alias Norovirus
Product Type Antibody
Formulation PBS with 20% glycerol and 0.025% ProClin 300; pH 7
Immunogen Synthetic Peptide encompassing a sequence within the center region of Norovirus VP1 (GII. 4) (Norovirus (Hu/GII.4/Sydney/NSW0514/2012/AU)). The exact sequence is proprietary.
Classification Polyclonal
Primary or Secondary Primary
2,157

CD14 Mouse anti-Human, PE-Cy7, Clone: M5E2, BD

Mouse Monoclonal Antibody

Content And Storage Store undiluted at 4°C and protected from prolonged exposure to light. Do not freeze.
Host Species Mouse
Conjugate PE-Cyanine7
Applications Flow Cytometry
Isotype IgG2a κ
Research Discipline Immunology
Antigen CD14
Regulatory Status RUO
Purification Method Affinity Purified
Formulation Aqueous buffered solution containing BSA and ≤0.09% sodium azide.
Immunogen Human CD14 Protein
Classification Monoclonal
Primary or Secondary Primary
Clone M5E2
2,158

Invitrogen™ IL-1 beta Polyclonal Antibody
GREENER_CHOICE

Rabbit Polyclonal Antibody

Content And Storage Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Target Species Human,Mouse
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Form Liquid
Gene Accession No. P01584, P10749
Isotype IgG
Concentration 1 mg/mL
Antigen IL-1 beta
Gene Symbols IL1B
Regulatory Status RUO
Purification Method Antigen affinity chromatography, Protein A
Gene Alias catabolin; cytokine; Hematopoietin 1 (H1); IFN beta inducing factor; il 1b; IL 1β; IL-1; IL1 B; IL-1 beta; IL-1 precursor; IL1B; IL-1B; IL1B1; IL1beta; IL-1beta; IL1-BETA; IL1F2; IL1β; ILN; Interleukin; interleukin 1 beta; Interleukin 1 beta precursor; interleukin 1, beta; interleukin 1, beta 1; interleukin 1-beta; interleukin*1*beta; Interleukin1 beta; interleukin-1 beta; interleukin-1 beta precursor; interleukin-1 beta precursor (AA -113 to 153); interleukin-1 beta proprotein; interleukin-1b; interleukin-1beta; interleukin-beta; LAF; lymphocyte proliferation-potentiating factor; Osteoclast activating factor (OAF); preinterleukin 1 beta; Pro interleukin 1 beta; prointerleukin-1 beta; pro-interleukin-1-beta
Gene IL1B
Product Type Antibody
Gene ID (Entrez) 16176, 3553
Formulation PBS with 50% glycerol and 0.05% ProClin 300; pH 7.4
Immunogen Recombinant protein Interleukin 1 Beta. The antigen corresponds to amino acid range 118-269 of the target protein.
Classification Polyclonal
Primary or Secondary Primary
2,159

Invitrogen™ CD45 Monoclonal Antibody (2D1), PerCP
GREENER_CHOICE

Mouse Monoclonal Antibody

Content And Storage 4°C, store in dark, DO NOT FREEZE!
Target Species Human
Host Species Mouse
Conjugate PerCP
Applications Flow Cytometry
Form Liquid
Gene Accession No. P08575
Isotype IgG1 κ
Concentration 0.09 mg/mL
Antigen CD45
Gene Symbols PTPRC
Regulatory Status RUO
Purification Method Size-exclusion chromatography
Gene Alias B220; cd45; CD45 antigen; CD45 antigen isoform 1 precursor; CD45 antigen isoform 2 precursor; CD45 antigen isoform 3 precursor; CD45 antigen isoform 4 precursor; CD45 antigen isoform 5 precursor; CD45 antigen isoform 6 precursor; CD45R; GP180; Lca; L-CA; leucocyte common antigen; leukocyte common antigen; leukocyte common antigen A; leukocyte common antigen B; leukocyte common antigen, CD45; loc; LOW QUALITY PROTEIN: receptor-type tyrosine-protein phosphatase C; LY5; Ly-5; lymphocyte antigen 5; lymphocyte common antigen; Lyt-4; membrane tyrosine phosphatase; protein tyrosine phosphatase lambda; protein tyrosine phosphatase receptor type C; protein tyrosine phosphatase, receptor type C; protein tyrosine phosphatase, receptor type, C; protein tyrosine phosphatase, receptor type, c polypeptide; Protein tyrosine phosphatase, receptor-type, c polypeptide; protein tyrosine phosphatase; alternatively spliced; Ptprc; Receptor-type tyrosine-protein phosphatase C; RT7; T200; T200 glycoprotein; T200 leukocyte common antigen; T220 and B220
Gene PTPRC
Product Type Antibody
Gene ID (Entrez) 5788
Formulation PBS with 0.2% BSA and 15mM sodium azide
Immunogen Human peripheral blood mononuclear cells.
Classification Monoclonal
Primary or Secondary Primary
Clone 2D1
2,160

CD45 Mouse anti-Human, Alexa Fluor 488, Clone: HI30, BD Pharmingen™

Mouse Monoclonal Antibody

Content And Storage Store undiluted at 4°C and protected from prolonged exposure to light. Do not freeze. The monoclonal antibody was purified from tissue culture supernatant or ascites by affinity chromatography. The antibody was conjugated to the dye under optimum conditions and unreacted dye was removed.
Target Species Human
Host Species Mouse
Conjugate Alexa Fluor 488
Applications Flow Cytometry
Form Liquid
Isotype IgG1 κ
Antigen CD45
Regulatory Status RUO
Gene Alias PTPRC; LCA; L-CA; Leukocyte Common Antigen; T200; GP180; LY5
Formulation Aqueous buffered solution containing BSA and ≤0.09% sodium azide.
Immunogen Human Peripheral Blood Leucocytes
Classification Monoclonal
Primary or Secondary Primary
Clone HI30